NAPA Antibody Summary
Synthetic peptide directed towards the N terminal of human NAPA. Peptide sequence MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN.
IgG
Polyclonal
Rabbit
NAPA
Protein A purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Western Blot 1:1000
This is a rabbit polyclonal antibody against NAPA and was validated on Western blot.
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Packaging, Storage & Formulations
Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NAPA Antibody
- alpha-SNAP
- alpha-soluble NSF attachment protein
- N-ethylmaleimide-sensitive factor attachment protein alpha
- N-ethylmaleimide-sensitive factor attachment protein, alpha
- S
- SNAPA
- SNAP-alpha
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.