BRIC Antibody (3F10) Summary
ATP8B1 (NP_005594.1 471 a.a. – 551 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
Reacts with ATPase, class I, type 8B, member 1.
IgG1 Kappa
Monoclonal
Mouse
ATP8B1
Protein A purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- ELISA
This antibody is reactive against recombinant protein in ELISA.
Packaging, Storage & Formulations
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
Protein A purified
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for BRIC Antibody (3F10)
- ATPase class I type 8B member 1
- ATPase, aminophospholipid transporter, class I, type 8B, member 1
- ATPase, class I, type 8B, member 1
- ATPICPFIC1
- BRIC
- EC 3.6.3
- EC 3.6.3.1
- Familial intrahepatic cholestasis type 1
- FIC1phospholipid-transporting ATPase IC
- PFICE1-E2 ATPase
- probable phospholipid-transporting ATPase IC
Background
This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
product targets : EAAT3 inhibitors