Name :
GUCA2B (Human) Recombinant Protein (P01)

Biological Activity :
Human GUCA2B full-length ORF (NP_009033.1, 1 a.a. – 112 a.a.) recombinant protein with GST tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_009033.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2981

Amino Acid Sequence :
MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Molecular Weight :
38.5

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
GUCA2B

Gene Alias :
GCAP-II, UGN

Gene Description :
guanylate cyclase activator 2B (uroguanylin)

Gene Summary :
Uroguanylin and guanylin (GUCA2A; MIM 139392), peptide homologs of the bacterial heat-stable enterotoxins (e.g., the E. coli ST toxin; STa), are endogenous activators of the guanylate cyclase-2C receptor (GUCY2C; MIM 601330), which synthesizes cyclic GMP (cGMP), a key component of several intracellular signal transduction pathways.[supplied by OMIM

Other Designations :
OTTHUMP00000007927|uroguanylin

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-4 Proteinmanufacturer
IL-22 Proteinmedchemexpress
Popular categories:
IL-17F
Butyrophilin Like 10 (BTNL10)