Name :
DEFB116 (Human) Recombinant Protein
Biological Activity :
Human DEFB116 (Q30KQ4, 24 a.a.- 102 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag :
Protein Accession No. :
Q30KQ4
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=245930
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI.
Molecular Weight :
11.5
Storage and Stability :
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
DEFB116 protein solution (0.5mg/ml) containing 20mM Tris-HCl buffer (pH8.0), 10% glycerol and 0.4M Urea.
Applications :
SDS-PAGE,
Gene Name :
DEFB116
Gene Alias :
DEFB-16
Gene Description :
defensin, beta 116
Gene Summary :
O
Other Designations :
beta-defensin 116|defensin, beta 16
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AZGP1 ProteinAccession
Neurotrophin-4 Proteinsupplier
Popular categories:
BTNL6
Pregnane X Receptor