gp130/CD130 Antibody (B-R3) [FITC] Summary
TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4 Da.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 Da.
Natural soluble gp130 receptor (Human).
Type I membrane (isoform 1). Secreted (isoform 2).
CD130 (B-R3)
IgG2a
Monoclonal
Mouse
IL6ST
IgG purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Flow Cytometry 1:10-1:1000
Reactivity Notes
Cross-reacts with Human. Not yet tested in other species.
Packaging, Storage & Formulations
Store at 4C in the dark.
PBS (pH 7.4) and 1.0% BSA
0.05% Sodium Azide
IgG purified
Alternate Names for gp130/CD130 Antibody (B-R3) [FITC]
- CD130 antigen
- CD130
- CDw130
- DKFZp564F053
- gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form
- gp130
- IL-6 receptor subunit beta
- IL-6R subunit beta
- IL-6RB
- IL-6R-beta
- IL6ST
- interleukin 6 signal transducer (gp130, oncostatin M receptor)
- interleukin receptor beta chain
- interleukin-6 receptor subunit beta
- Interleukin-6 signal transducer
- Membrane glycoprotein 130
- membrane glycoprotein gp130
- Oncostatin-M receptor subunit alpha
Background
CD130 is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.