ZNF85 Antibody (2G9) Summary
ZNF85 (NP_003420, 2 a.a. – 76 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT
zinc finger protein 85 (HPF4, HTF1)
IgG2b Kappa
Monoclonal
Mouse
ZNF85
IgG purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- ELISA
- Immunohistochemistry-Paraffin
Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P.
Packaging, Storage & Formulations
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ZNF85 Antibody (2G9)
- HPF4
- HTF1
- MGC78566
- zinc finger protein 85 (HPF4, HTF1)
- zinc finger protein 85
- Zinc finger protein HPF4
- Zinc finger protein HTF1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
product targets :　Protein Tyrosine Kinase_RTK inhibitors