S100A3 Antibody Summary
Synthetic peptides corresponding to S100A3(S100 calcium binding protein A3) The peptide sequence was selected from the N terminal of S100A3. Peptide sequence MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF.
IgG
Polyclonal
Rabbit
S100A3
Protein A purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
This is a rabbit polyclonal antibody against S100A3 and was validated on Western Blot and immunohistochemistry-P
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Packaging, Storage & Formulations
Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for S100A3 Antibody
- Protein S-100E
- S100 calcium binding protein A3
- S100 calcium-binding protein A3S100Eprotein S100-A3
Background
S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
product targets :　Aromatase inhibitors