Recombinant Human TSCOT Protein Summary
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 227-282 of Human SLC46A2 partial ORF
Source: Wheat Germ (in vitro)
Amino Acid Sequence:LKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTT
Recombinant Protein
SLC46A2
Applications/Dilutions
Product may contain endotoxins and is not suitable for use with live cells.
Packaging, Storage & Formulations
Store at -80C. Avoid freeze-thaw cycles.
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
No Preservative
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human TSCOT Protein
- Solute carrier family 46 member 2
- solute carrier family 46, member 2
- thymic stromal cotransporter homolog
- thymic stromal co-transporter
- TSCOTLy110
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.