Recombinant Human TGF beta induced factor 2 Protein Summary
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 114-175 of Human TGIF2 partial ORF
Source: Wheat Germ (in vitro)
Amino Acid Sequence:LAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSP
Recombinant Protein
TGIF2
Applications/Dilutions
Product may contain endotoxins and is not suitable for use with live cells.
Packaging, Storage & Formulations
Store at -80C. Avoid freeze-thaw cycles.
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
No Preservative
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human TGF beta induced factor 2 Protein
- homeobox protein TGIF2
- TGF(beta)-induced transcription factor 2
- TGF-beta-induced transcription factor 2,5-TG-3-interacting factor 2,5-TG-3 interacting factor 2
- TGFB-induced factor 2 (TALE family homeobox)
- TGFB-induced factor 2
- TGFB-induced factor homeobox 2
- transcription growth factor-beta-induced factor 2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.