Recombinant Human RAD18 Protein Summary
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-495 of Human RAD18 full-length ORF
Source: Wheat Germ (in vitro)
Amino Acid Sequence:MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN
Recombinant Protein
RAD18
Applications/Dilutions
Product may contain endotoxins and is not suitable for use with live cells.
Packaging, Storage & Formulations
Store at -80C. Avoid freeze-thaw cycles.
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
No Preservative
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human RAD18 Protein
- EC 6.3.2.-
- hHR18
- hRAD18
- postreplication repair protein hRAD18p
- Postreplication repair protein RAD18
- RAD18 homolog (S. cerevisiae)
- RAD18, S. cerevisiae, homolog
- RING finger protein 73
- RNF73E3 ubiquitin-protein ligase RAD18
Background
RAD18 – RAD18 homolog (S. cerevisiae)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.
product targets : Bcl-7 Family inhibitors