Recombinant Human CD28 Protein Summary
An un-tagged recombinant protein corresponding to the amino acids 1-220 of Human CD28 full-length ORF
Source: Wheat Germ (in vitro)
Amino Acid Sequence:MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Recombinant Protein
CD28
Packaging, Storage & Formulations
Store at -80C. Avoid freeze-thaw cycles.
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
No Preservative
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CD28 Protein
- CD28 antigen (Tp44)
- CD28 antigen
- CD28 molecule
- CD28
- MGC138290
- T-cell-specific surface glycoprotein CD28
- Tp44
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.
product targets : Monoamine Transporter inhibitors