RSK1 Antibody (2E3.) Summary
RPS6KA1 (NP_002944 342 a.a. – 416 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD
RPS6KA1 (2E3)
IgG2b Kappa
Monoclonal
Mouse
RPS6KA1
IgG purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Western Blot
- ELISA
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Packaging, Storage & Formulations
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RSK1 Antibody (2E3.)
- 90kD, polypeptide 1)
- EC 2.7.11
- EC 2.7.11.1,90 kDa ribosomal protein S6 kinase 1
- HU-1
- MAP kinase-activated protein kinase 1a
- MAPK-activated protein kinase 1a
- MAPKAP kinase 1a
- MAPKAPK-1a
- MAPKAPL1A
- p90RSK1
- p90S6K
- ribosomal protein S6 kinase alpha 1
- ribosomal protein S6 kinase alpha-1
- ribosomal protein S6 kinase, 90kD, polypeptide 1
- ribosomal protein S6 kinase, 90kDa, polypeptide 1
- Ribosomal S6 kinase 1
- RPS6KA1
- RSK
- RSK1
- RSK-1
- RSK1p90-RSK 1
- S6K-alpha 1
- S6K-alpha-1
Background
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.