RNPC3 Antibody Summary
Synthetic peptides corresponding to RNPC3(RNA-binding region (RNP1, RRM) containing 3) The peptide sequence was selected from the middle region of RNPC3. Peptide sequence LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA.
IgG
Polyclonal
Rabbit
RNPC3
Immunogen affinity purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Western Blot 1:100-1:2000
This is a rabbit polyclonal antibody against RNPC3 and was validated on Western blot.
Packaging, Storage & Formulations
Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RNPC3 Antibody
- FLJ20008
- FLJ25070
- KIAA183
- KIAA1839
- RBM40U11/U12 snRNP 65 kDa protein
- RNA recognition protein
- RNA-binding motif protein 40
- RNA-binding protein 40
- RNA-binding region (RNP1, RRM) containing 3
- RNA-binding region-containing protein 3
- RNP
- U11/U12 small nuclear ribonucleoprotein 65 kDa protein
- U11/U12 snRNP 65K
- U11/U12-65K
Background
RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. RNPC3 participates in pre-mRNA U12-dependent splicing. RNPC3 binds to the 3-stem-loop of m7G-capped U12 snRNA.Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 65K protein that is a component of the U12-type spliceosome. This protein contains two RNA recognition motifs (RRMs), suggesting that it may contact one of the small nuclear RNAs of the minor spliceosome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.