PIGF Antibody Summary
Synthetic peptides corresponding to PIGF(phosphatidylinositol glycan anchor biosynthesis, class F) The peptide sequence was selected from the N terminal of PIGF. Peptide sequence MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF.
IgG
Polyclonal
Rabbit
PIGF
Immunogen affinity purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Western Blot 1:100-1:2000
- Immunohistochemistry
This is a rabbit polyclonal antibody against PIGF and was validated on Western blot.
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Packaging, Storage & Formulations
Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PIGF Antibody
- GPI11 homolog
- MGC32646
- MGC33136
- phosphatidylinositol glycan anchor biosynthesis, class F
- phosphatidylinositol glycan, class F
- phosphatidylinositol-glycan biosynthesis class F protein
- PIG-F
Background
PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
product targets :　Adenosine Deaminase inhibitors