MOX1 Partial Protein Summary
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 165 – 252 of Human MEOX1 partial ORF
Source: Wheat Germ (in vitro)
Amino Acid Sequence:PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Partial Protein
MEOX1
Applications/Dilutions
Product may contain endotoxins and is not suitable for use with live cells.
Packaging, Storage & Formulations
Store at -80C. Avoid freeze-thaw cycles.
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
No Preservative
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MOX1 Partial Protein
- homeobox protein MOX-1
- mesenchyme homeobox 1MOX1mesenchyme homeo box 1
Background
This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.