Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody Summary
Synthetic peptides corresponding to GNS(glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID)) The peptide sequence was selected from the C terminal of GNS.Peptide sequence PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA.
IgG
Polyclonal
Rabbit
GNS
Immunogen affinity purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
This is a rabbit polyclonal antibody against GNS and was validated on Western blot.
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Packaging, Storage & Formulations
Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody
- EC 3.1.6
- EC 3.1.6.14
- G6Sglucosamine-6-sulfatase
- glucosamine (N-acetyl)-6-sulfatase
- Glucosamine6Sulfatase
- Glucosamine-6-Sulfatase
- GNS
- MGC21274
- N-acetylglucosamine-6-sulfatase
Background
GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.