DDX49 Antibody Summary
Synthetic peptides corresponding to DDX49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49) The peptide sequence was selected from the N terminal of DDX49.Peptide sequence ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR.
IgG
Polyclonal
Rabbit
DDX49
Protein A purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Western Blot 1:100-1:2000
This is a rabbit polyclonal antibody against DDX49 and was validated on Western blot.
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Packaging, Storage & Formulations
Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for DDX49 Antibody
- DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
- DEAD box protein 49
- EC 3.6.1
- EC 3.6.4.13
- FLJ10432
- probable ATP-dependent RNA helicase DDX49
- R27090_2
Background
The function of Anti-DDX49 has not yet been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.