Cytokeratin 75 Antibody Summary
This antibody was developed against Recombinant Protein corresponding to amino acids:MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
IgG
Polyclonal
Rabbit
KRT75
Immunogen affinity purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:50-1:200
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (81%)
Packaging, Storage & Formulations
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified
Alternate Names for Cytokeratin 75 Antibody
- CK-75
- cytokeratin-75
- hK6hf
- K6HFcytokeratin type II
- K75
- KB18
- keratin 75
- keratin, type II cytoskeletal 75
- Keratin-6 hair follicle
- keratin-75
- PFB
- type II keratin-18
- Type II keratin-K6hf
- Type-II keratin Kb18
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
product targets :　VDAC inhibitors