CD69 Antibody Summary
This antibody was developed against a recombinant protein corresponding to amino acids: VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
IgG
Polyclonal
Rabbit
CD69
Immunogen affinity purified
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
Applications/Dilutions
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 – 1:200
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Packaging, Storage & Formulations
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified
Alternate Names for CD69 Antibody
- activation inducer molecule (AIM/CD69)
- Activation inducer molecule
- AIM
- BL-AC/P26
- CD69 antigen (p60, early T-cell activation antigen)
- CD69 antigen
- CD69 molecule
- CD69
- CLEC2CC-type lectin domain family 2 member C
- C-type lectin domain family 2, member C
- EA1
- EA-1
- early activation antigen CD69
- early lymphocyte activation antigen
- Early T-cell activation antigen p60
- GP32/28
- Leu23
- Leukocyte surface antigen Leu-23
- MLR-3
- p60
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
product targets :　DYRK inhibitors